PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vocar.0002s0569.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Volvox
Family CO-like
Protein Properties Length: 406aa    MW: 43479.1 Da    PI: 4.542
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vocar.0002s0569.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box231.7e-07231535
             zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHk 35
                          C  +  + ++ +Ce+++ llC+dC + +H 
  Vocar.0002s0569.1.p  2 ACVVCAAQ-ASVYCENDKALLCKDCDVRIHM 31
                         699***99.*******************994 PP

2CCT65.41.7e-22338382145
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                          Re+++ RY+eKrk+RkFeK+irY+sRKa+Ae RpR+KGrF+k++e
  Vocar.0002s0569.1.p 338 REQRVARYREKRKNRKFEKTIRYASRKAYAEIRPRIKGRFAKKEE 382
                          9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF006433.2E-5231IPR000315B-box-type zinc finger
CDDcd000219.94E-5342No hitNo description
PROSITE profilePS5101716.311338380IPR010402CCT domain
PfamPF062032.0E-17338380IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MACVVCAAQA SVYCENDKAL LCKDCDVRIH MSNAVAARHV RRIPCEGGCS KGASLFCRCD  60
NAYMCEACHC ANPLAATHET EPTAPLPLME QENAVAEQPH ATGPCESVAQ SAASPVAWFV  120
DDEKPSLGSF EEPIMLSPAG SEAVVPVMSA PADDFTFTEP ATFKEIKDKL EFESLEFDNS  180
WMELNFDFTD ILSDGPSDVG LVPTFDLEGV DPVADATVPS VAEEVVVAES DAATEIHRKR  240
TAEPSDEEPA AKLPAISEAA TTALGLHAAF QMTQPASLFF QSAVAQPSLL PPMVPPAVIS  300
PLATTAAAPP LQPPPTAVQS KSSAAYNTAL AAGANLTREQ RVARYREKRK NRKFEKTIRY  360
ASRKAYAEIR PRIKGRFAKK EEIEAWKAAH GGEDAVVPEI LDGEF*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002945772.10.0B-box zinc finger protein
TrEMBLD8THS70.0D8THS7_VOLCA; B-box zinc finger protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP6111112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.13e-18CONSTANS-like 3